Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ORL1/OPRL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	ORL1/OPRL1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16914320 View Documents View Product Certificates	Novus Biologicals NBP16914320UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP169143 View Documents View Product Certificates	Novus Biologicals NBP169143	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ORL1/OPRL1 Polyclonal specifically detects ORL1/OPRL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ORL1/OPRL1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	Kappa-type 3 opioid receptor, KOR-3MGC34578, nociceptin receptor, NOCIR, OORORL1kappa3-related opioid receptor, opiate receptor-like 1, Orphanin FQ receptor
Gene Symbols	OPRL1
Isotype	IgG
Molecular Weight of Antigen	41 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P79292
Gene ID (Entrez)	4987
Immunogen	Synthetic peptides corresponding to OPRL1 (opiate receptor-like 1) The peptide sequence was selected from the middle region of OPRL1. Peptide sequence ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ORL1/OPRL1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents