Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OSBPL3 Antibody, Novus Biologicals™
SDP

Catalog No. NB15727020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB15727020 20 μL
NBP155151 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB15727020 Supplier Novus Biologicals Supplier No. NBP15515120UL

Rabbit Polyclonal Antibody

OSBPL3 Polyclonal specifically detects OSBPL3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen OSBPL3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. A4D169
Gene Alias DKFZp667P1518, KIAA0704ORP3ORP-3OSBP3, MGC21526, OSBP-related protein 3, oxysterol binding protein-like 3, oxysterol-binding protein 3, oxysterol-binding protein-related protein 3
Gene Symbols OSBPL3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3 (NP_663160). Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
Molecular Weight of Antigen 98 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26031
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.