Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OSBPL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15515120UL
Description
OSBPL3 Polyclonal specifically detects OSBPL3 in Human, Mouse samples. It is validated for Western Blot.Specifications
OSBPL3 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
A4D169 | |
OSBPL3 | |
Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3 (NP_663160). Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE. | |
Affinity Purified | |
RUO | |
26031 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp667P1518, KIAA0704ORP3ORP-3OSBP3, MGC21526, OSBP-related protein 3, oxysterol binding protein-like 3, oxysterol-binding protein 3, oxysterol-binding protein-related protein 3 | |
Rabbit | |
98 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction