Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OSBPL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $548.00

Specifications

Antigen	OSBPL3
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB15727020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15515120UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155151 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155151	100 μL	Each for $548.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

OSBPL3 Polyclonal specifically detects OSBPL3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen	OSBPL3
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	A4D169
Gene ID (Entrez)	26031
Immunogen	Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3 (NP_663160). Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp667P1518, KIAA0704ORP3ORP-3OSBP3, MGC21526, OSBP-related protein 3, oxysterol binding protein-like 3, oxysterol-binding protein 3, oxysterol-binding protein-related protein 3
Gene Symbols	OSBPL3
Isotype	IgG
Molecular Weight of Antigen	98 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

OSBPL3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents