OSBPL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155151

Catalog No. NBP155151

Description

OSBPL3 Polyclonal specifically detects OSBPL3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: OSBPL3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp667P1518, KIAA0704ORP3ORP-3OSBP3, MGC21526, OSBP-related protein 3, oxysterol binding protein-like 3, oxysterol-binding protein 3, oxysterol-binding protein-related protein 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 98 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A4D169
• Gene Symbols: OSBPL3
• Immunogen: Synthetic peptides corresponding to OSBPL3(oxysterol binding protein-like 3) The peptide sequence was selected from the N terminal of OSBPL3 (NP_663160). Peptide sequence MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26031
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.