OSBPL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23885825UL

Catalog No. NB396635

Description

OSBPL5 Polyclonal specifically detects OSBPL5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OSBPL5
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9H0X9
• Gene Symbols: OSBPL5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LCGLPASATVHPDQDLFPLNGSSLENDAFSDKSERENPEESDTETQDHSRKTESGSDQSETPGAPVRRGTTYVEQVQEEL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.2.1, EC 2.7.7.6, FLJ42929, KIAA1534oxysterol-binding protein-related protein 5, OBPH1, ORP-5, ORP5oxysterol-binding protein homologue 1, OSBP-related protein 5, oxysterol binding protein-like 5, oxysterol-binding protein homolog 1, Oxysterol-binding protein homolog 1;
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114879
• Target Species: Human
• Isotype: IgG