OSER1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156864

Catalog No. NBP156864

Description

OSER1 Polyclonal specifically detects OSER1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C20orf111
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51526
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NX31
• Gene Symbols: C20ORF111
• Immunogen: Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Rat: 100%; Western clawed frog: 100%; Xenopus: 100%; Sumatran orangutan: 100%; Bovine: 100%; Mouse: 100%; Human: 100%; Chicken: 92%; Channel catfish: 92%; Green puffer: 92%; Zebrafish: 92%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG