Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OSER1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | C20orf111 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156864
![]() |
Novus Biologicals
NBP156864 |
100 μL |
Each for $480.74
|
|
|||||
NBP15686420
![]() |
Novus Biologicals
NBP15686420UL |
20 μL | N/A | N/A | N/A | ||||
Description
OSER1 Polyclonal specifically detects OSER1 in Human samples. It is validated for Western Blot.Specifications
| C20orf111 | |
| Polyclonal | |
| Rabbit | |
| Q9NX31 | |
| 51526 | |
| Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1 | |
| C20ORF111 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title