OSGIN1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159296	100 μL

Catalog No. NBP159296 Supplier Novus Biologicals Supplier No. NBP159296

Description

Rabbit Polyclonal Antibody

OSGIN1 Polyclonal specifically detects OSGIN1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OSGIN1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9UJX0
• Gene Alias: BDGI, bone marrow stromal cell-derived growth inhibitor, EC 1.6.5, EC 2.4.2.7, EC 2.7.1.130, huOKL38, OKL38oxidative stress-induced growth inhibitor 1, Ovary, kidney and liver protein 38, oxidative stress induced growth inhibitor 1, pregnancy induced growth inhibitor, Pregnancy-induced growth inhibitor OKL38
• Gene Symbols: OSGIN1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to OSGIN1(oxidative stress induced growth inhibitor 1) The peptide sequence was selected from the N terminal of OSGIN1. Peptide sequence APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 29948
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Rabbit: 100%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rat: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only