OSGIN1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159296

Catalog No. NBP159296

Description

OSGIN1 Polyclonal specifically detects OSGIN1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OSGIN1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BDGI, bone marrow stromal cell-derived growth inhibitor, EC 1.6.5, EC 2.4.2.7, EC 2.7.1.130, huOKL38, OKL38oxidative stress-induced growth inhibitor 1, Ovary, kidney and liver protein 38, oxidative stress induced growth inhibitor 1, pregnancy induced growth inhibitor, Pregnancy-induced growth inhibitor OKL38
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29948
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UJX0
• Gene Symbols: OSGIN1
• Immunogen: Synthetic peptides corresponding to OSGIN1(oxidative stress induced growth inhibitor 1) The peptide sequence was selected from the N terminal of OSGIN1. Peptide sequence APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Rabbit: 100%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only