Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. OSMR beta Antibody, Novus Biologicals™

OSMR beta Antibody, Novus Biologicals™
SDP

Catalog No. NBP16254320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16254320 20 μL
NBP162543 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16254320 Supplier Novus Biologicals Supplier No. NBP16254320UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

OSMR beta Polyclonal specifically detects OSMR beta in Human samples. It is validated for Western Blot.

Specifications

Antigen OSMR
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q99650
Gene Alias IL-31 receptor subunit beta, IL-31R subunit beta, IL-31RB, IL-31R-beta, Interleukin-31 receptor subunit beta, MGC150627, MGC75127, oncostatin M receptor, oncostatin-M specific receptor beta subunit, oncostatin-M-specific receptor subunit beta, OSMRBMGC150626
Gene Symbols OSMR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to OSMR(oncostatin M receptor) The peptide sequence was selected from the N terminal of OSMR. Peptide sequence YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ.
Molecular Weight of Antigen 110 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9180
Test Specificity This product is specific to Subunit or Isoform: beta.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.