Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OSMR beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Applications | Western Blot |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16254320
|
Novus Biologicals
NBP16254320UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP162543
|
Novus Biologicals
NBP162543 |
100 μL |
Each for $487.50
|
|
|||||
Description
OSMR beta Polyclonal specifically detects OSMR beta in Human samples. It is validated for Western Blot.Specifications
| Western Blot | |
| Unconjugated | |
| RUO | |
| IL-31 receptor subunit beta, IL-31R subunit beta, IL-31RB, IL-31R-beta, Interleukin-31 receptor subunit beta, MGC150627, MGC75127, oncostatin M receptor, oncostatin-M specific receptor beta subunit, oncostatin-M-specific receptor subunit beta, OSMRBMGC150626 | |
| OSMR | |
| IgG | |
| This product is specific to Subunit or Isoform: beta. |
| Polyclonal | |
| Rabbit | |
| Q99650 | |
| 9180 | |
| Synthetic peptides corresponding to OSMR(oncostatin M receptor) The peptide sequence was selected from the N terminal of OSMR. Peptide sequence YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ. | |
| Primary | |
| 110 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title