OSMR beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162544

Catalog No. NBP162544

Description

OSMR beta Polyclonal specifically detects OSMR beta in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OSMR beta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: IL-31 receptor subunit beta, IL-31R subunit beta, IL-31RB, IL-31R-beta, Interleukin-31 receptor subunit beta, MGC150627, MGC75127, oncostatin M receptor, oncostatin-M specific receptor beta subunit, oncostatin-M-specific receptor subunit beta, OSMRBMGC150626
• Host Species: Rabbit
• Molecular Weight of Antigen: 110 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta.
• Target Species: Human, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q99650
• Gene Symbols: OSMR
• Immunogen: Synthetic peptides corresponding to OSMR(oncostatin M receptor) The peptide sequence was selected from the middle region of OSMR. Peptide sequence LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9180
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only