Osteocalcin Antibody (190125) [DyLight 594], Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals FAB1419M

Catalog No. NB400056

Description

Osteocalcin Monoclonal antibody specifically detects Osteocalcin in Human, Rat samples. It is validated for Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF

Specifications

• Antigen: Osteocalcin
• Classification: Monoclonal
• Conjugate: DyLight 594
• Formulation: 50mM Sodium Borate
• Host Species: Mouse
• Purification Method: Protein A or G purified from hybridoma culture supernatant
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified

• Applications: Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF
• Clone: 190125
• Dilution: Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready
• Gene Alias: BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
• Immunogen: Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818
• Quantity: 0.1 mL
• Research Discipline: Extracellular Matrix, Stem Cell Markers
• Gene ID (Entrez): 632
• Content And Storage: Store at 4°C in the dark.
• Isotype: IgG1