Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB400052

Osteocalcin Antibody (190125) [DyLight 755], Novus Biologicals™
SDP

Catalog No. NB400052 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB400052 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB400052 Supplier Novus Biologicals Supplier No. FAB1419Z
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Osteocalcin Monoclonal antibody specifically detects Osteocalcin in Human, Rat samples. It is validated for Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF

Specifications

Antigen Osteocalcin
Applications Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF
Classification Monoclonal
Clone 190125
Conjugate DyLight 755
Dilution Immunohistochemistry, Intracellular Staining by Flow Cytometry, Immunocytochemistry, CyTOF-ready
Formulation 50mM Sodium Borate
Gene Alias BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
Host Species Mouse
Immunogen Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818
Purification Method Protein A or G purified from hybridoma culture supernatant
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Extracellular Matrix, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 632
Target Species Human, Rat
Content And Storage Store at 4°C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.