Learn More
Description
Specifications
Specifications
| Antigen | p19 INK4d |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CDK inhibitor p19INK4d, cell cycle inhibitor, Nur77 associating protein, cyclin-dependent kinase 4 inhibitor D, cyclin-dependent kinase 4 inhibitor D p19, cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4), inhibitor of cyclin-dependent kinase 4d, INK4D, p19, p19-INK4D |
| Gene Symbols | CDKN2D |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
