Learn More
Description
Specifications
Specifications
| Antigen | P2X6/P2RX6 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2), 40% Glycerol |
| Gene Alias | ATP receptor, MGC129625, P2RXL1skeletal muscle-expressed P2X, P2X purinoceptor 6, P2X6purinoceptor P2X6, P2XMpurinoreceptor P2X6, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 6, Purinergic receptor P2X-like 1, purinergic receptor P2X-like 1, orphan receptor |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN |
| Purification Method | Immunogen affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
