Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

P2X6/P2RX6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP24858425UL

View more versions of this product

Catalog No. NB396094

$382.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

P2X6/P2RX6 Polyclonal antibody specifically detects P2X6/P2RX6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	P2X6/P2RX6
Classification	Polyclonal
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	ATP receptor, MGC129625, P2RXL1skeletal muscle-expressed P2X, P2X purinoceptor 6, P2X6purinoceptor P2X6, P2XMpurinoreceptor P2X6, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 6, Purinergic receptor P2X-like 1, purinergic receptor P2X-like 1, orphan receptor
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: VTQIKELGNRLWDVADFVKPPQGENVFFLVTNFLVTPAQVQGRCPEHPSVPLAN
Quantity	25 μL
Research Discipline	Cancer, Cardiovascular Biology, Endocrinology, Neuroscience, Signal Transduction
Gene ID (Entrez)	9127
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

P2X6/P2RX6 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions