Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. P2X6/P2RX6 Antibody, Novus Biologicals™

P2X6/P2RX6 Antibody, Novus Biologicals™
SDP

Catalog No. NB396095 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396095 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396095 Supplier Novus Biologicals Supplier No. NBP24858325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

P2X6/P2RX6 Polyclonal antibody specifically detects P2X6/P2RX6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen P2X6/P2RX6
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias ATP receptor, MGC129625, P2RXL1skeletal muscle-expressed P2X, P2X purinoceptor 6, P2X6purinoceptor P2X6, P2XMpurinoreceptor P2X6, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 6, Purinergic receptor P2X-like 1, purinergic receptor P2X-like 1, orphan receptor
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: HFYWRTKYEEAKAPKATANSVWRELALASQARLAECLRRSSAPAPTATAAGSQTQTPGWPCPSSDTHLPTHS
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9127
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.