P2X7/P2RX7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP182738

Catalog No. NBP182738

Description

P2X7/P2RX7 Polyclonal specifically detects P2X7/P2RX7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: P2X7/P2RX7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: P2RX7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.7mg/mL
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ATP receptor, MGC20089, P2X purinoceptor 7, P2X7P2X7 receptor, P2X7R, P2Z receptor, Purinergic receptor, purinergic receptor P2X, ligand-gated ion channel, 7, purinergic receptor P2X7 variant A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5027
• Target Species: Human
• Isotype: IgG

For Research Use Only