Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

P2Y10/P2RY10 Antibody, Novus Biologicals™
SDP

Catalog No. NB394558 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB394558 25 μL
NBP256283 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB394558 Supplier Novus Biologicals Supplier No. NBP25628325UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

P2Y10/P2RY10 Polyclonal specifically detects P2Y10/P2RY10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen P2Y10/P2RY10
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10
Gene Symbols P2RY10
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cytokine Research, GPCR, Plasma Membrane Markers
Primary or Secondary Primary
Gene ID (Entrez) 27334
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.