Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

p38 delta/SAPK4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15825620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15825620 20 μL
NBP158256 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15825620 Supplier Novus Biologicals Supplier No. NBP15825620UL

Rabbit Polyclonal Antibody

p38 delta/SAPK4 Polyclonal specifically detects p38 delta/SAPK4 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen p38 delta/SAPK4
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O15264
Gene Alias EC 2.7.11, EC 2.7.11.24, MAP kinase 13, MAPK 13, MGC99536, mitogen-activated protein kinase 13, Mitogen-activated protein kinase p38 delta, p38delta, PRKM13, SAPK4MAP kinase p38 delta, Stress-activated protein kinase 4
Gene Symbols MAPK13
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MAPK13(mitogen-activated protein kinase 13) The peptide sequence was selected from the middle region of MAPK13. Peptide sequence KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5603
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.