Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. p38 delta/SAPK4 Antibody, Novus Biologicals™

p38 delta/SAPK4 Antibody, Novus Biologicals™
SDP

Catalog No. NB431463 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB431463 25 μL
NBP187373 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB431463 Supplier Novus Biologicals Supplier No. NBP18737325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

p38 delta/SAPK4 Polyclonal specifically detects p38 delta/SAPK4 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen p38 delta/SAPK4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.11, EC 2.7.11.24, MAP kinase 13, MAPK 13, MGC99536, mitogen-activated protein kinase 13, Mitogen-activated protein kinase p38 delta, p38delta, PRKM13, SAPK4MAP kinase p38 delta, Stress-activated protein kinase 4
Gene Symbols MAPK13
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5603
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.