p38 gamma/SAPK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15827020UL

Catalog No. NBP15827020

Description

p38 gamma/SAPK3 Polyclonal specifically detects p38 gamma/SAPK3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: p38 gamma/SAPK3
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P53778
• Gene Symbols: MAPK12
• Immunogen: Synthetic peptides corresponding to MAPK12(mitogen-activated protein kinase 12) The peptide sequence was selected from the N terminal of MAPK12. Peptide sequence SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE.
• Quantity: 20 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6300
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC 2.7.11.24, Stress-activated protein kinase 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG