Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p38 gamma/SAPK3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | p38 gamma/SAPK3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15827020
|
Novus Biologicals
NBP15827020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158270
|
Novus Biologicals
NBP158270 |
100 μL |
Each for $487.50
|
|
|||||
Description
p38 gamma/SAPK3 Polyclonal specifically detects p38 gamma/SAPK3 in Human samples. It is validated for Western Blot.Specifications
| p38 gamma/SAPK3 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC 2.7.11.24, Stress-activated protein kinase 3 | |
| MAPK12 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P53778 | |
| 6300 | |
| Synthetic peptides corresponding to MAPK12(mitogen-activated protein kinase 12) The peptide sequence was selected from the N terminal of MAPK12. Peptide sequence SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title