p38 gamma/SAPK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23872925UL

Catalog No. NB396696

Description

p38 gamma/SAPK3 Polyclonal specifically detects p38 gamma/SAPK3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: p38 gamma/SAPK3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P53778
• Gene Symbols: MAPK12
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6300
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.7.11, ERK3, ERK-6, ERK6MAPK 12, Extracellular signal-regulated kinase 6, MAP kinase 12, MAP kinase p38 gamma, mitogen-activated protein kinase 12, mitogen-activated protein kinase 3, Mitogen-activated protein kinase p38 gamma, P38GAMMA, PRKM12, SAPK-3, SAPK3EC 2.7.11.24, Stress-activated protein kinase 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.