Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
p40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157003
Description
p40 Polyclonal specifically detects p40 in Human samples. It is validated for Western Blot.Specifications
p40 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
40 kDa Rab9 effector protein, bA65N13.1, p40, Rab9 effector p40, Rab9 effector protein with kelch motifs, RAB9P40DKFZp686P1077, RABEPK | |
Rabbit | |
Affinity purified | |
RUO | |
10244 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q7Z6M1 | |
RABEPK | |
Synthetic peptides corresponding to RABEPK (Rab9 effector protein with kelch motifs) The peptide sequence was selected from the N terminal of RABEPK. Peptide sequence MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Pig: 100%; Canine: 92%; Mouse: 92%; Rabbit: 85%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction