p53 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256234

Catalog No. NBP256234

Description

p53 Polyclonal specifically detects p53 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: p53
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Antigen NY-CO-13, FLJ92943, LFS1TRP53, p53, p53 tumor suppressor, P53cellular tumor antigen p53, Phosphoprotein p53, transformation-related protein 53, tumor protein p53, Tumor suppressor p53
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TP53
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Cellular Markers, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, HIF Target Genes, Hypoxia, Neuroscience, Neurotransmission, p53 Pathway, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
• Gene ID (Entrez): 7157
• Target Species: Human
• Isotype: IgG

For Research Use Only