Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

p70 S6 Kinase/S6K Antibody, Novus Biologicals™
SDP

Catalog No. NBP238448 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238448 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP238448 Supplier Novus Biologicals Supplier No. NBP238448
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

p70 S6 Kinase/S6K Polyclonal specifically detects p70 S6 Kinase/S6K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen p70 S6 Kinase/S6K
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P23443
Gene Alias EC 2.7.11, EC 2.7.11.1, p70 ribosomal S6 kinase alpha, p70 S6 kinase alpha, p70 S6 kinase, alpha 1,70 kDa ribosomal protein S6 kinase 1, p70 S6 kinase, alpha 2, p70 S6KA, p70 S6K-alpha, p70(S6K)-alpha, p70-alpha, p70-S6K, P70S6K1, PS6K, ribosomal protein S6 kinase beta-1, Ribosomal protein S6 kinase I, ribosomal protein S6 kinase, 70kD, polypeptide 1, ribosomal protein S6 kinase, 70kDa, polypeptide 1, S6K, S6K1p70-S6K 1, S6K-beta-1, serine/threonine kinase 14 alpha, Serine/threonine-protein kinase 14A, STK14A
Gene Symbols RPS6KB1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Autophagy, Cancer, mTOR Pathway, Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6198
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.