Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PA28 Activator alpha Subunit/PSME1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP18312125UL
Description
PA28 Activator alpha Subunit/PSME1 Polyclonal specifically detects PA28 Activator alpha Subunit/PSME1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PA28 Activator alpha Subunit/PSME1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
11S regulator complex alpha subunit, 11S regulator complex subunit alpha, 29-kD MCP activator subunit, IFI5111MGC8628, IGUP I-5111, Interferon gamma up-regulated I-5111 protein, interferon-gamma IEF SSP 5111, interferon-gamma-inducible protein 5111, PA28a, PA28alphaActivator of multicatalytic protease subunit 1, proteasome (prosome, macropain) activator subunit 1 (PA28 alpha), Proteasome activator 28 subunit alpha, proteasome activator complex subunit 1, proteasome activator subunit-1, REGalpha, REG-alpha | |
Rabbit | |
Affinity Purified | |
RUO | |
5720 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PSME1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction