Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PA28 Activator alpha Subunit/PSME1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$382.00 - $646.00
Specifications
Antigen | PA28 Activator alpha Subunit/PSME1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PA28 Activator alpha Subunit/PSME1 Polyclonal specifically detects PA28 Activator alpha Subunit/PSME1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PA28 Activator alpha Subunit/PSME1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
5720 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:AVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Rabbit | |
Human | |
11S regulator complex alpha subunit, 11S regulator complex subunit alpha, 29-kD MCP activator subunit, IFI5111MGC8628, IGUP I-5111, Interferon gamma up-regulated I-5111 protein, interferon-gamma IEF SSP 5111, interferon-gamma-inducible protein 5111, PA28a, PA28alphaActivator of multicatalytic protease subunit 1, proteasome (prosome, macropain) activator subunit 1 (PA28 alpha), Proteasome activator 28 subunit alpha, proteasome activator complex subunit 1, proteasome activator subunit-1, REGalpha, REG-alpha | |
PSME1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title