PA28 Activator beta Subunit/PSME2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25762825UL

Catalog No. NB435364

Description

PA28 Activator beta Subunit/PSME2 Polyclonal specifically detects PA28 Activator beta Subunit/PSME2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PA28 Activator beta Subunit/PSME2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (PA28 beta), Proteasome activator 28 subunit beta, proteasome activator 28-beta, proteasome activator complex subunit 2, proteasome activator hPA28 subunit beta, REGbeta, REG-beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PSME2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK
• Quantity: 25 μL
• Research Discipline: Neuroscience, Ubiquitin Proteasome Pathway
• Gene ID (Entrez): 5721
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only