Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PA28 Activator beta Subunit/PSME2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | PA28 Activator beta Subunit/PSME2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PA28 Activator beta Subunit/PSME2 Polyclonal specifically detects PA28 Activator beta Subunit/PSME2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| PA28 Activator beta Subunit/PSME2 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience, Ubiquitin Proteasome Pathway | |
| 11S regulator complex beta subunit, 11S regulator complex subunit beta, Activator of multicatalytic protease subunit 2, MCP activator, 31-kD subunit, PA28b, PA28betacell migration-inducing protein 22, proteasome (prosome, macropain) activator subunit 2 (PA28 beta), Proteasome activator 28 subunit beta, proteasome activator 28-beta, proteasome activator complex subunit 2, proteasome activator hPA28 subunit beta, REGbeta, REG-beta | |
| PSME2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5721 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKVLSLLALVK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title