Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PA28 Activator gamma Subunit/PSME3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154587 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154587 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154587 Supplier Novus Biologicals Supplier No. NBP154587
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PA28 Activator gamma Subunit/PSME3 Polyclonal specifically detects PA28 Activator gamma Subunit/PSME3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PA28 Activator gamma Subunit/PSME3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P61289-2
Gene Alias 11S regulator complex gamma subunit, 11S regulator complex subunit gamma, Activator of multicatalytic protease subunit 3, Ki, Ki antigen, PA28g, PA28gamma, PA28-gamma, PA28GKi nuclear autoantigen, proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki), Proteasome activator 28 subunit gamma, proteasome activator 28-gamma, proteasome activator complex subunit 3, REG-gamma
Gene Symbols PSME3
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human PA28 Activator gamma Subunit/PSME3. Peptide Sequence PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ. The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 31 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Immune System Diseases, Immunology, Neuroscience, Stem Cell Markers, Ubiquitin Proteasome Pathway
Primary or Secondary Primary
Gene ID (Entrez) 10197
Test Specificity This product is specific to Subunit or Isoform: 3.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.