PABPC1L2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254693

Catalog No. NBP254693

Description

PABPC1L2A Polyclonal specifically detects PABPC1L2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PABPC1L2A
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: MGC168104, PABPC1L2, PABPC1L2B, poly(A) binding protein, cytoplasmic 1-like 2A, polyadenylate-binding protein 1-like 2, RBM32A, RBM32B, RNA binding motif protein 32A, RNA-binding motif protein 32, RNA-binding protein 32
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 340529
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PABPC1L2A
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:KSHKEREAERGAWARQSTSADVKDFEEDTDEEATLR
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.