Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PABPC4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157448 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157448 100 μL
NBP15744820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157448 Supplier Novus Biologicals Supplier No. NBP157448
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PABPC4 Polyclonal specifically detects PABPC4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PABPC4
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q13310
Gene Alias APP1FLJ43938, APP-1PABP-4, Inducible poly(A)-binding protein, IPABP, iPABPpoly(A)-binding protein, cytoplasmic 4 (inducible form), PABP4Activated-platelet protein 1, poly(A) binding protein, cytoplasmic 4 (inducible form), Poly(A)-binding protein 4, polyadenylate-binding protein 4
Gene Symbols PABPC4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PABPC4 (poly(A) binding protein, cytoplasmic 4 (inducible form)) The peptide sequence was selected from the N terminal of PABPC4. Peptide sequence AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8761
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Bovine: 92%; Pig: 92%; Rabbit: 92%; Mouse: 85%; Rat: 85%; Xenopus: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.