Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PAFAH1B2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156301 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156301 100 μL
NBP1563020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP156301 Supplier Novus Biologicals Supplier No. NBP156301
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PAFAH1B2 Polyclonal specifically detects PAFAH1B2 in Human samples. It is validated for Western Blot.

Specifications

Antigen PAFAH1B2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O35264
Gene Alias EC 3.1.1.47, intracellular platelet-activating factor acetylhydrolase alpha 2 subunit, PAF acetylhydrolase 30 kDa subunit, PAF-AH 30 kDa subunit, PAFAH subunit beta, PAF-AH subunit beta, PAF-AH1b alpha 2 subunit, PAFAHB, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa), platelet-activating factor acetylhydrolase IB subunit beta, platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)
Gene Symbols PAFAH1B2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PAFAH1B2(platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa) The peptide sequence was selected from the N terminal of PAFAH1B2. Peptide sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5049
Test Specificity This product is specific to Subunit or Isoform: beta.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.