Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAFAH1B2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15630120UL
Description
PAFAH1B2 Polyclonal specifically detects PAFAH1B2 in Human, Rat samples. It is validated for Western Blot.Specifications
PAFAH1B2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O35264 | |
PAFAH1B2 | |
Synthetic peptides corresponding to PAFAH1B2(platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa) The peptide sequence was selected from the N terminal of PAFAH1B2. Peptide sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLD | |
20 μL | |
Primary | |
This product is specific to Subunit or Isoform: beta. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 3.1.1.47, intracellular platelet-activating factor acetylhydrolase alpha 2 subunit, PAF acetylhydrolase 30 kDa subunit, PAF-AH 30 kDa subunit, PAFAH subunit beta, PAF-AH subunit beta, PAF-AH1b alpha 2 subunit, PAFAHB, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa), platelet-activating factor acetylhydrolase IB subunit beta, platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa) | |
Rabbit | |
Affinity Purified | |
RUO | |
5049 | |
Human, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction