Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PAG3 Antibody, Novus Biologicals™
SDP

Catalog No. NB301413 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301413 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301413 Supplier Novus Biologicals Supplier No. NBP325039
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PAG3 Polyclonal antibody specifically detects PAG3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen PAG3
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, centaurin, beta 3, CENTB3, DDEF2FLJ42910, development and differentiation enhancing factor 2, Development and differentiation-enhancing factor 2, KIAA0400AMAP2, Pap-alpha, PAPPAG3, Paxillin-associated protein with ARF GAP activity 3, PYK2 C terminus-associated protein, Pyk2 C-terminus-associated protein, SHAG1
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein PAG3 using the following amino acid sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers, Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 8853
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.