PAGE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158313

Catalog No. NBP158313

Description

PAGE1 Polyclonal specifically detects PAGE1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PAGE1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CT16.3, G antigen, family B, 1 (prostate associated), GAGE9, GAGE-9AL5, GAGEB1G antigen family B member 1, P antigen family, member 1 (prostate associated), PAGE-1G antigen 9, prostate associated gene 1, Prostate-associated gene 1 protein
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8712
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75459
• Gene Symbols: PAGE1
• Immunogen: Synthetic peptides corresponding to PAGE1(P antigen family, member 1 (prostate associated)) The peptide sequence was selected from the middle region of PAGE1. Peptide sequence TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human
• Form: Purified