Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PAIP1 Antibody, Novus Biologicals™

PAIP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15731020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15731020 20 μL
NBP157310 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15731020 Supplier Novus Biologicals Supplier No. NBP15731020UL

Description

Rabbit Polyclonal Antibody

PAIP1 Polyclonal specifically detects PAIP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PAIP1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.25 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H074-2
Gene Alias MGC12360, PABC1-interacting protein 1, PABP-interacting protein 1, PAIP-1, poly(A) binding protein interacting protein 1, Poly(A)-binding protein-interacting protein 1, polyadenylate binding protein-interacting protein 1, polyadenylate-binding protein-interacting protein 1
Gene Symbols PAIP1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PAIP1 (poly(A) binding protein interacting protein 1) The peptide sequence was selected from the C terminal of PAIP1 (NP_877590). Peptide sequence EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10605
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.