PAIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180954

Catalog No. NBP180954

Description

PAIP2 Polyclonal specifically detects PAIP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PAIP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9BPZ3
• Gene Symbols: PAIP2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNA
• Quantity: 0.1 mL
• Research Discipline: metabolism
• Gene ID (Entrez): 51247
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MGC72018, PABC1-interacting protein 2, PABP-interacting protein 2, PAIP-2, PAIP2APoly(A)-binding protein-interacting protein 2, poly(A) binding protein interacting protein 2, polyA-binding protein-interacting protein 2, polyadenylate-binding protein-interacting protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only