pan-Synuclein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24733825UL

Catalog No. NB396252

Description

pan-Synuclein Polyclonal specifically detects pan-Synuclein in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: pan-Synuclein
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Lewy body) 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SNCA
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
• Quantity: 25 μL
• Research Discipline: Alzheimers Research, Apoptosis, Cell Biology, Cytoskeleton Markers, Neurodegeneration, Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 6622
• Target Species: Human
• Isotype: IgG

For Research Use Only