Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. pan-Synuclein Antibody, Novus Biologicals™

pan-Synuclein Antibody, Novus Biologicals™
SDP

Catalog No. NBP247338 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP247338 0.1 mL
NB396252 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP247338 Supplier Novus Biologicals Supplier No. NBP247338
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

pan-Synuclein Polyclonal specifically detects pan-Synuclein in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen pan-Synuclein
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Lewy body) 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Gene Symbols SNCA
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Alzheimers Research, Apoptosis, Cell Biology, Cytoskeleton Markers, Neurodegeneration, Neuroscience, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6622
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.