Pancreatic Lipase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15803420UL

Catalog No. NBP15803420

Description

Pancreatic Lipase Polyclonal specifically detects Pancreatic Lipase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Pancreatic Lipase
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P16233
• Gene Symbols: PNLIP
• Immunogen: Synthetic peptides corresponding to PNLIP (pancreatic lipase) The peptide sequence was selected from the C terminal of PNLIP. Peptide sequence GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.1.21, EC 3.1.1.3, pancreatic lipasepancreatic triacylglycerol lipase, PL, PTL, triacylglycerol acylhydrolase
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5406
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG