Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Pancreatic Lipase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $499.50
Specifications
| Antigen | Pancreatic Lipase |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15803420
|
Novus Biologicals
NBP15803420UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP158034
|
Novus Biologicals
NBP158034 |
100 μL |
Each for $499.50
|
|
|||||
Description
Pancreatic Lipase Polyclonal specifically detects Pancreatic Lipase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Pancreatic Lipase | |
| Polyclonal | |
| Purified | |
| RUO | |
| EC 3.1.1.21, EC 3.1.1.3, pancreatic lipasepancreatic triacylglycerol lipase, PL, PTL, triacylglycerol acylhydrolase | |
| PNLIP | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| P16233 | |
| 5406 | |
| Synthetic peptides corresponding to PNLIP (pancreatic lipase) The peptide sequence was selected from the C terminal of PNLIP. Peptide sequence GHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVTLSGKKVTGHILV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title