PAPD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169060

Catalog No. NBP169060

Description

PAPD4 Polyclonal specifically detects PAPD4 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: PAPD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.7.19, FLJ38499, GLD2TUTase 2, hGLD-2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, poly(A) RNA polymerase GLD2, Terminal uridylyltransferase 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5U315
• Gene Symbols: TENT2
• Immunogen: Synthetic peptides corresponding to Papd4 (PAP associated domain containing 4) The peptide sequence was selected from the C terminal of Papd4. Peptide sequence YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 167153
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.