Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PAPD4 Antibody, Novus Biologicals™

PAPD4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16906020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16906020 20 μL
NBP169060 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16906020 Supplier Novus Biologicals Supplier No. NBP16906020UL

Description

Rabbit Polyclonal Antibody

PAPD4 Polyclonal specifically detects PAPD4 in Rat samples. It is validated for Western Blot.

Specifications

Antigen PAPD4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5U315
Gene Alias EC 2.7.7.19, FLJ38499, GLD2TUTase 2, hGLD-2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, poly(A) RNA polymerase GLD2, Terminal uridylyltransferase 2
Gene Symbols PAPD4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Papd4 (PAP associated domain containing 4) The peptide sequence was selected from the C terminal of Papd4. Peptide sequence YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 167153
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.