Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAPD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15305720UL
Description
PAPD4 Polyclonal specifically detects PAPD4 in Human samples. It is validated for Western Blot.Specifications
PAPD4 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q6PIY7 | |
PAPD4 | |
Synthetic peptides corresponding to PAPD4(PAP associated domain containing 4) The peptide sequence was selected from the N terminal of PAPD4. Peptide sequence GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.7.7.19, FLJ38499, GLD2TUTase 2, hGLD-2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, poly(A) RNA polymerase GLD2, Terminal uridylyltransferase 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
167153 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction