Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PAPD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | PAPD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15305720
|
Novus Biologicals
NBP15305720UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP153057
|
Novus Biologicals
NBP153057 |
100 μL |
Each for $487.50
|
|
|||||
Description
PAPD4 Polyclonal specifically detects PAPD4 in Human samples. It is validated for Western Blot.Specifications
| PAPD4 | |
| Polyclonal | |
| Rabbit | |
| Q6PIY7 | |
| 167153 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.7.7.19, FLJ38499, GLD2TUTase 2, hGLD-2, PAP associated domain containing 4, PAP-associated domain-containing protein 4, poly(A) RNA polymerase GLD2, Terminal uridylyltransferase 2 | |
| Synthetic peptides corresponding to PAPD4(PAP associated domain containing 4) The peptide sequence was selected from the N terminal of PAPD4. Peptide sequence GRKRLSDEKNLPLDGKRQRFHSPHQEPTVVNQIVPLSGERRYSMPPLFHT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title