DNA Polymerase gamma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179290

Catalog No. NBP179290

Description

DNA Polymerase gamma Polyclonal specifically detects DNA Polymerase gamma in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: DNA Polymerase gamma
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA polymerase subunit gamma-1, EC 2.7.7.7, FLJ27114, MDP1, MIRAS, Mitochondrial DNA polymerase catalytic subunit, MTDPS4A, PolG, catalytic subunit, POLG1MTDPS4B, PolG-alpha, POLGAPEO, polymerase (DNA directed), gamma, SANDO, SCAE
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5428
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_445980
• Gene Symbols: POLG
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Zebrafish: 92%; Pig: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
• Isotype: IgG