PAPOLG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255535

Catalog No. NBP255535

Description

PAPOLG Polyclonal specifically detects PAPOLG in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PAPOLG
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.7.7.19, FLJ11805, FLJ12972, FLJ13482, FLJ14187, MGC133307, MGC133308, neo-PAP, Neo-poly(A) polymerase, nuclear poly(A) polymerase gamma, PAP2, PAPG, PAP-gamma, poly(A) polymerase gamma, Polynucleotide adenylyltransferase gamma, SRP RNA 3' adenylating enzyme/pap2, SRP RNA 3'-adenylating enzyme
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64895
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PAPOLG
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKTVSPPTVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKT
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only