Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PAPSS2 Antibody, Novus Biologicals™

PAPSS2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155135 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155135 100 μL
NBP15513520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP155135 Supplier Novus Biologicals Supplier No. NBP155135
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PAPSS2 Polyclonal specifically detects PAPSS2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PAPSS2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95340-2
Gene Alias 3'-phosphoadenosine 5'-phosphosulfate synthase 2, ATP sulfurylase/adenosine 5'-phosphosulfate kinase, ATPSK2ATP sulfurylase/APS kinase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2, bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2, EC 2.7.1.25, PAPS synthase 2, PAPS synthetase 2, PAPSS 2, SK 2, SK2, Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2
Gene Symbols PAPSS2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PAPSS2(3'-phosphoadenosine 5'-phosphosulfate synthase 2) The peptide sequence was selected from the C terminal of PAPSS2. Peptide sequence PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN.
Molecular Weight of Antigen 70 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 9060
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.